Anti-EP4 Receptor (C-term): SureLight™ APC, 50ug

$329.00

SKU: D3-1866 Category:

Description

Anti-EP4 (Prostaglandin E4) Receptor (C-term.) conjugated to SureLight™ APC, 50ug

Antibody: Rabbit anti-EP4 Receptor (C-term.) IgG

Reactivity: Human, murine, rat, and ovine EP4 receptor; non-reactive with EP1, EP2, and EP3 receptors; other species not tested.

Uses: Flow cytometry and cell-based assays

Reviews

There are no reviews yet.

Be the first to review “Anti-EP4 Receptor (C-term): SureLight™ APC, 50ug”

Your email address will not be published. Required fields are marked *

Anti-EP4 (Prostaglandin E4) Receptor (C-term.) conjugated to SureLight™ APC, 50ug

Antibody: Rabbit anti-EP4 Receptor (C-term.) IgG

Reactivity: Human, murine, rat, and ovine EP4 receptor; non-reactive with EP1, EP2, and EP3 receptors; other species not tested.

Uses: Flow cytometry and cell-based assays

Antibody:
Size:
50ug
Dye:
SureLight™ Allophycocyanin (APC)
Excitation max. λ:
650nm
Emission max. λ:
660nm
Specificity:
EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)
Form / Storage:
Upon receipt, store kit at 2-8°C.
Stability:

Product should be stored at 2-8°C in the dark and be used within 3 months.  If further dilution of the conjugate is required, use diluted material within one week.