Anti-EP4 Receptor (C-term): SureLight® APC;50ug

$409.16

SKU: D3-1866 Category:

Product Details

Antibody:
Size:
50ug
Excitation max. λ:
650nm
Emission max. λ:
660nm
Host:
Rabbit
Target:
EP4 Receptor
Reactivity:
EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)
Conjugate/Tag:
SureLight® Allophycocyanin (APC)
Clonality:
Polyclonal
Isotype:
IgG
Form / Storage:
Upon receipt, store kit at 2-8˚C.
Stability:

Product should be stored at 2-8˚C in the dark and be used within 3 months. ?If further dilution of the conjugate is required, use diluted material within one week.

Technical Info:

TR-FRET ResourcesLearn more about how TR-FRET assays work

Additional TR-FRET Assay Reagents Explore additional reagents for enhanced assay performance

Reviews

There are no reviews yet.

Be the first to review “Anti-EP4 Receptor (C-term): SureLight® APC;50ug”

Your email address will not be published. Required fields are marked *