Anti-EP4 Receptor (C-term): SureLight™ R-PE;50ug

$350.00

SKU: D5-1866 Category:

Product Details


Notice: Undefined variable: linklist in /home/customer/www/columbiabiosciences.com/public_html/wp-content/themes/cbio/woocommerce/description-details.php on line 32

Notice: Undefined variable: linklist_antibody in /home/customer/www/columbiabiosciences.com/public_html/wp-content/themes/cbio/woocommerce/description-details.php on line 49
Antibody:
Size:
50ug
Excitation max. λ:
565>498nm
Emission max. λ:
578nm
Host:
Rabbit
Target:
EP4 Receptor
Reactivity:
EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)
Conjugate/Tag:
SureLight™ R-Phycoerythrin
Clonality:
Polyclonal
Form / Storage:
Upon receipt, store at 2-8°C.
Stability:

Product should be stored at 2-8°C in the dark and be used within 3 months.  If further dilution of the conjugate is required, use diluted material within one week.


Deprecated: woocommerce_get_template is deprecated since version 3.0! Use wc_get_template instead. in /home/customer/www/columbiabiosciences.com/public_html/wp-includes/functions.php on line 5211

Reviews

There are no reviews yet.

Be the first to review “Anti-EP4 Receptor (C-term): SureLight™ R-PE;50ug”

Your email address will not be published. Required fields are marked *