Anti-EP4 Receptor (C-term): SureLight™ R-PE, 50ug


SKU: D5-1866 Category:


Anti-EP4 (Prostaglandin E4) Receptor (C-term.) conjugated to SureLight™ R-PE, 50ug

Antibody: Rabbit anti-EP4 REceptor (C-term.) IgG

Isotype: IgG

Reactivity: Human, murine, rat, and ovine EP4 receptor; non-reactive with EP1, EP2, and EP3 receptors; other species not tested.

Uses: Flow cytometry and cell-based assays



There are no reviews yet.

Be the first to review “Anti-EP4 Receptor (C-term): SureLight™ R-PE, 50ug”

Your email address will not be published. Required fields are marked *

SureLight™ R-Phycoerythrin
Excitation max. λ:
Emission max. λ:
EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)
Form / Storage:
Upon receipt, store at 2-8°C.

Product should be stored at 2-8°C in the dark and be used within 3 months.  If further dilution of the conjugate is required, use diluted material within one week.