Anti-EP4 Receptor (C-term): SureLight™ R-PE;50ug

$350.00

SKU: D5-1866 Category:

Product Details

Antibody:
Size:
50ug
Excitation max. λ:
565>498nm
Emission max. λ:
578nm
Reactivity:
EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)
Conjugate/Tag:
SureLight™ R-Phycoerythrin
Form / Storage:
Upon receipt, store at 2-8°C.
Stability:

Product should be stored at 2-8°C in the dark and be used within 3 months.  If further dilution of the conjugate is required, use diluted material within one week.

Reviews

There are no reviews yet.

Be the first to review “Anti-EP4 Receptor (C-term): SureLight™ R-PE;50ug”

Your email address will not be published. Required fields are marked *